PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00455_0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 434aa    MW: 46211 Da    PI: 6.2318
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00455_0030genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.2e-165297147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++ Ed+ll ++v+ +G+++W++Iar ++ gR++k+c++rw + 
    kfl00455_0030 52 KGPWSAAEDDLLHRLVEHFGPRNWTLIARGIQ-GRSGKSCRLRWCNQ 97
                     79******************************.***********985 PP

2Myb_DNA-binding59.95.5e-19104148147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T eEd +++ a++++G++ W+tIar ++ gRt++ +k++w++ 
    kfl00455_0030 104 RKPFTDEEDAKIIAAHAEHGNK-WATIARLLP-GRTDNAIKNHWNST 148
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.8484798IPR017930Myb domain
SuperFamilySSF466899.36E-3051145IPR009057Homeodomain-like
SMARTSM007171.0E-1451100IPR001005SANT/Myb domain
PfamPF002491.3E-155297IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-2553105IPR009057Homeodomain-like
CDDcd001672.05E-135496No hitNo description
PROSITE profilePS5129426.16199153IPR017930Myb domain
SMARTSM007173.1E-17103151IPR001005SANT/Myb domain
PfamPF002495.0E-16104148IPR001005SANT/Myb domain
CDDcd001673.29E-13106149No hitNo description
Gene3DG3DSA:1.10.10.602.7E-25106152IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MSSEIGQEQQ LQTGHESFQS RGEGDGGAGS HLSGGEGQGP APNNVSREET IKGPWSAAED  60
DLLHRLVEHF GPRNWTLIAR GIQGRSGKSC RLRWCNQLNP QVKRKPFTDE EDAKIIAAHA  120
EHGNKWATIA RLLPGRTDNA IKNHWNSTLS RRFLDIDGQI VDIFGRKRSY SVDGDLDGQA  180
GDSEHSQSSA QELLAESAKR ARLDLGHYTT AQQPLPSAST PFYHPSLHQP PSSRPETSEA  240
TFLSLTLPPQ SLSHPSSSTS RSPHSRPVSV VPNHCGRGCC RSGVDDPGRG VRGPLLSQEM  300
FEEGEGDDPK LPGLPIGSAT GPLTGAPLSG SDVVGDPSAV FSSVISTAVA QAMRPMLQAT  360
GAGDGDELPT AVTPSELQSN PFMALMRDAV AKAVQAQSLQ AADTTQRVDN GPSGQLSPSL  420
TQQLVGSFLQ HSQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-40491521104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD7THE04e-58D7THE0_VITVI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-53myb domain protein 109